Protein Info for AMB_RS10185 in Magnetospirillum magneticum AMB-1

Annotation: sulfurtransferase FdhD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF02634: FdhD-NarQ" amino acids 29 to 286 (258 residues), 228.3 bits, see alignment E=6.1e-72 TIGR00129: formate dehydrogenase family accessory protein FdhD" amino acids 78 to 286 (209 residues), 161.7 bits, see alignment E=9.6e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb2017)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5Q4 at UniProt or InterPro

Protein Sequence (294 amino acids)

>AMB_RS10185 sulfurtransferase FdhD (Magnetospirillum magneticum AMB-1)
MSKLVDGISHVAAVRLDRSAVDEEVCSVIAEDTLTIAVEGVGTYTLMWTPTGGDRTAMAY
TPADGILGDAGVAEPLAMAVGFLFTEGIIEAVSDLRAVAFCPDDAKVVTAYLVDPARPQP
RRRDVIMNSSCGVCGEGGRLEELIATLPRAGEGMVVEIAALHRLMDEMGSRQAVFAATGG
AHAAAVFDAVGRIVASAEDLGRHNALDKVIGRCLLDGIDTSACGVLLSSRLSLEMVTKAA
RARFQLVAAVSAPTSLAVEVASQRGITLCGFLRAGRCTVYSHRHRIGELRGWVN