Protein Info for AMB_RS09935 in Magnetospirillum magneticum AMB-1

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 348 to 372 (25 residues), see Phobius details PF00909: Ammonium_transp" amino acids 12 to 400 (389 residues), 291.5 bits, see alignment E=4.6e-91

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1969)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5V2 at UniProt or InterPro

Protein Sequence (425 amino acids)

>AMB_RS09935 ammonium transporter (Magnetospirillum magneticum AMB-1)
METTKTGADVLFILLGAVMVLAMHSGFAFLEVGTVRKKNQVNALVKILSDFAVSTIVYFF
VGYSVAYGTTFLVGADVLIGKTGSAFAASGYDLVKFFFLATFAAAIPAIVSGGIAERAKF
TTQLMATAVLVGLVYPLFEGMVWGTRFGFQDLMKGWFGFAFHDFAGSVVVHAVGGWIGLA
AVLMLGVRLGRYRKDGRLVAFPPSNIPFLALGAWVLSVGWFGFNVMSAQVIADISGLVAI
NSLMAMVGGIVTSLLVGRNDPGFIHNGALAGLVAVCAGSDVMHPVGALVTGGIAGAMFVW
LFNLCQAKFKIDDVLGVWALHGMCGFLGGIACGVFGQEALGGLGGVSLGAQVTGTVMGAA
FGLAGGLAVYGGLKATLGIRLSDEEEFAGADLSIHQIGAYPEDATTMHDDGLAMSVHSAN
KRKAG