Protein Info for AMB_RS09865 in Magnetospirillum magneticum AMB-1

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF21926: FeeM" amino acids 32 to 149 (118 residues), 34.5 bits, see alignment E=1.8e-12 PF13444: Acetyltransf_5" amino acids 36 to 137 (102 residues), 109.6 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1955)

Predicted SEED Role

"Putative hemolysin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W5W6 at UniProt or InterPro

Protein Sequence (259 amino acids)

>AMB_RS09865 GNAT family N-acetyltransferase (Magnetospirillum magneticum AMB-1)
MTHQATTVHALNPATADGLEVRLAESRAEVAAAQRIRYRVFYEEMGAKPTLSMRALELDF
DDYDRHCDHLLVLADGEVVGTYRLIRRKAAEAVGRFYSAGEFDISPFLAADGEILELGRS
CVDARWRHRGTLQALWQGLAAYMVENDIRLLFGCGSLPGTDPAILAPQLAYLRDNHMAPP
ALRGRALDSAEKVDFSTIDVAWDARRVLASLPPLLKGYLRLGGVIGDGAVIDRPFNTTDV
LVVVNAADIAGRYVKRFSA