Protein Info for AMB_RS09665 in Magnetospirillum magneticum AMB-1

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF00072: Response_reg" amino acids 5 to 110 (106 residues), 76.3 bits, see alignment E=6.5e-25 PF00158: Sigma54_activat" amino acids 139 to 303 (165 residues), 211.3 bits, see alignment E=2.3e-66 PF14532: Sigma54_activ_2" amino acids 140 to 310 (171 residues), 58.2 bits, see alignment E=3.6e-19 PF07728: AAA_5" amino acids 162 to 279 (118 residues), 30.4 bits, see alignment E=1.1e-10 PF25601: AAA_lid_14" amino acids 312 to 379 (68 residues), 65.3 bits, see alignment E=1.1e-21 PF02954: HTH_8" amino acids 399 to 433 (35 residues), 34.1 bits, see alignment 5.4e-12

Best Hits

KEGG orthology group: K02481, two-component system, NtrC family, response regulator (inferred from 100% identity to mag:amb1914)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W607 at UniProt or InterPro

Protein Sequence (443 amino acids)

>AMB_RS09665 sigma-54-dependent Fis family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MSKLLLVDDEPAFLRLAAAWLEKQGHSVETAADGARAREAFLRERPDLVLLDLVMPPERT
PEAGLARIPDFAAVPVVVLTAHADHDLALRAVAAGAWDFLAKPVEPDLLRFVVELALLKR
GLEQEVASLRAAQPTEDGIFGSSPVILRLKEMIRRIAPADLPVMVLGPSGTGKELVAHAL
HAASPRRSGPFVAVHCGAIPAELLESELFGHLKDSFTGAHQDRQGLVAAAHGGTLFPDEV
GEMPPSMQVKLLRFLQEDTYSPVGGRQPLTADVRVVSATHRDIEAMAVEGSFREDFYYRL
KGLILRSPPLAERREDIAPLAARFLADAAKRRRLHLTAEALAWLAEQDWPGNVRELKAVV
TSAAALAEGSVLTLADLAFARSGDPATLPQAAPATLAETVADLERRLIITALAATGNNHS
AAACRLGLSRVGLLKMMTRLGLR