Protein Info for AMB_RS09645 in Magnetospirillum magneticum AMB-1

Annotation: K(+)-transporting ATPase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 transmembrane" amino acids 37 to 54 (18 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 249 to 276 (28 residues), see Phobius details amino acids 569 to 591 (23 residues), see Phobius details amino acids 610 to 630 (21 residues), see Phobius details amino acids 650 to 674 (25 residues), see Phobius details TIGR01497: K+-transporting ATPase, B subunit" amino acids 10 to 670 (661 residues), 998.3 bits, see alignment E=1.5e-304 TIGR01494: HAD ATPase, P-type, family IC" amino acids 73 to 345 (273 residues), 99.9 bits, see alignment E=1.2e-32 amino acids 369 to 593 (225 residues), 155.6 bits, see alignment E=1.6e-49 PF00122: E1-E2_ATPase" amino acids 108 to 208 (101 residues), 68.5 bits, see alignment E=3.9e-23 PF00702: Hydrolase" amino acids 301 to 524 (224 residues), 91 bits, see alignment E=1.4e-29

Best Hits

Swiss-Prot: 68% identical to KDPB_STRCO: Potassium-transporting ATPase ATP-binding subunit (kdpB) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K01547, K+-transporting ATPase ATPase B chain [EC: 3.6.3.12] (inferred from 100% identity to mag:amb1910)

Predicted SEED Role

"Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W611 at UniProt or InterPro

Protein Sequence (676 amino acids)

>AMB_RS09645 K(+)-transporting ATPase subunit B (Magnetospirillum magneticum AMB-1)
MSIHRPQALSLFDGPILAQAARGALVKLDPRRLVRNPIMFTTALVSLAATVLTLRDIAVG
ASAGITVQICVWLWFTVLFANFAEAIAEGRGKAQAASLRRSKSEAVARRVADLAGTSPAT
VPAASLRAGDLVLCEAGDVIPGDGDVEAGIATVDESAITGESAPVIRESGGDRSAVTGGT
RVVSDRIMVRITANPGETFLDRMIALVEGAKRQKTPNEIALSILLVGMTLIFLVVVASLP
AWASWSGTAIPMVFLIALFITLIPTTIGGLLSAIGIAGMDRLVKFNVIAKSGRAVEAAGD
IDVLLLDKTGTITLGARQASEFLPLAGTSERDLAEAAFLSSLADDTPEGKSIVALARMRF
GFNDPVAAMKFVPFSAQTRMSGVDAGGDSIRKGASDAILRHVADAAPRELMPVVEKVAKA
GGTPLVVARNGRALGVIHLKDIVKPGIRERFATLRAMGIRTVMITGDNPLTAAAIAAEAG
VDDFLAEATPERKLELIRDYQRGGRLVAMCGDGSNDAPALAQADVGVAMNTGTQAAREAG
NMVDLESDPTKLIEIVMIGKQLLMSRGALTTFSIANDVAKYFAIIPALFLVSYPQLQALN
VMGLASPQSAILSAIIFNALIIVTLIPLALRGVQYRPADAGTLLKRNLAVYGLGGLLAPF
AGIKLIDMAVAALGLA