Protein Info for AMB_RS09485 in Magnetospirillum magneticum AMB-1

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 55 (55 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 60 to 394 (335 residues), 267.2 bits, see alignment E=8.2e-84 PF25973: BSH_CzcB" amino acids 86 to 217 (132 residues), 37.6 bits, see alignment E=5.1e-13 PF25917: BSH_RND" amino acids 86 to 225 (140 residues), 67.8 bits, see alignment E=1.9e-22 PF25876: HH_MFP_RND" amino acids 125 to 193 (69 residues), 32.1 bits, see alignment E=3.5e-11 PF25944: Beta-barrel_RND" amino acids 233 to 317 (85 residues), 50.3 bits, see alignment E=7.7e-17 PF25954: Beta-barrel_RND_2" amino acids 262 to 318 (57 residues), 30.9 bits, see alignment 7.8e-11 PF25967: RND-MFP_C" amino acids 324 to 383 (60 residues), 39.7 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1876)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W645 at UniProt or InterPro

Protein Sequence (408 amino acids)

>AMB_RS09485 efflux RND transporter periplasmic adaptor subunit (Magnetospirillum magneticum AMB-1)
MTASPRFAKAPIFSKGPVFSKGRALLLATVALAALGGGAVLLRGAPGQPAQAAAAQAAPV
TVQTMALRNVQVWSSFSGRMRAVDFAEIRPEVSGRLTQVRINDGQTVKAGDVLFVIDPAP
FEAALAKAEANLATARTNAVFARTELDRAVNLIKTEAIAQRLYDERANADKVSHSAVLAA
EAELKQAHINLDHAYVKAPIAGRVSRAEITLGNVVQAGPGAPLLTSIVSNDGIYADFEVD
EQTYMKGIRTQDGSRDKERRIPVQITVRGDEAHPYLGTIQSFDNRIDTASGTIRARARFD
NGDGALMPGMFVSVKVASGGDEPALLVQERAIGSDQSKKFVYVVGDDGKVAYREVGLGPQ
VDGSRIVLAGLKAGEKVIVDGLQHVRPNMAVTVQEASLGTLRHDIAAN