Protein Info for AMB_RS09475 in Magnetospirillum magneticum AMB-1

Annotation: outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 13 to 468 (456 residues), 272.9 bits, see alignment E=2.6e-85 PF02321: OEP" amino acids 80 to 262 (183 residues), 96.6 bits, see alignment E=7.9e-32 amino acids 290 to 467 (178 residues), 80.2 bits, see alignment E=8.2e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1874)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W647 at UniProt or InterPro

Protein Sequence (476 amino acids)

>AMB_RS09475 outer membrane protein (Magnetospirillum magneticum AMB-1)
MSKRKIAPSALVLTGLLLAACTSPAGPQDSGIETPSLWSRLTGSAPAKADPTAPLVLGPD
AEVEQTWWRRFGDPTLDTLVADALAGNQTLAMAKARVEEAQAARGLARSRLLPDISAAGS
AQRANQGYATGDKAVGVAEIDLKATWELDLFGRNQARMAEANALLQSEEATRQGVRVALL
AEVARSYFDLRDAIRQIELTRQNLGTQRRTLEIIRAQRQGALASDFDVQRAGARVSATEA
LIPSLETARDVALNRLSVLLGRVPGGRDALLAELPQAKPLNPSVAIAAPAKVLAARPDVR
AAERRFAASLSAKDAATAELFPNISLAALFGTQTATPMNATPWGIGLTLVQPILNFGRIE
SQIDAADARQRQAFLAYQRSVLEALEDMENALSRYGHEAGRNVALATGVAQNRRASELAH
TQFTNGYTGLLDVLVAERDLLDAEAAQAASDTSLRRNLIAIYAAAGGGWDDSADGR