Protein Info for AMB_RS09425 in Magnetospirillum magneticum AMB-1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 69 to 92 (24 residues), see Phobius details amino acids 112 to 139 (28 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 249 (169 residues), 52.6 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1864)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W657 at UniProt or InterPro

Protein Sequence (255 amino acids)

>AMB_RS09425 ABC transporter permease (Magnetospirillum magneticum AMB-1)
MASPVTASRSRRPAMFAGIAVFLGLWEAAARTGLIPAILVPPPSSVVAAFQKEAGSGMWL
TYVVASLGHYSAGVLIGSVLGITLGVASALWPLVEASQEGIARLLRPIPPIAWIPFAIIW
FGVTEGAAAFIIAIGVFWLNYFAANTAVKGVDRGLIELAHAFGQGSLVKRLLKVVLPGAA
PGLFSGLRAGLGMGWIAVLAAELFGISGIGQRMMEASGVLATDIVLLYMATIALLYAIFD
GAVIWVAERTLRWTH