Protein Info for AMB_RS09375 in Magnetospirillum magneticum AMB-1

Annotation: nitrate ABC transporter substrate-binding proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13379: NMT1_2" amino acids 20 to 239 (220 residues), 53.5 bits, see alignment E=6.3e-18 PF04069: OpuAC" amino acids 22 to 220 (199 residues), 28.9 bits, see alignment E=1.8e-10 PF12974: Phosphonate-bd" amino acids 43 to 155 (113 residues), 40.4 bits, see alignment E=4.5e-14 PF09084: NMT1" amino acids 49 to 237 (189 residues), 60.4 bits, see alignment E=4.9e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1854)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W667 at UniProt or InterPro

Protein Sequence (305 amino acids)

>AMB_RS09375 nitrate ABC transporter substrate-binding proteins (Magnetospirillum magneticum AMB-1)
MTRLLALAVTLFLALPAAAQDKLRLGYPAGMNGQIVTILEKANLAAARGQEVEYTFFQNG
PPMMEAFAAGQLDVAVTSLMPLATFAARLPGQAVIVSGLGHSSYALLVKAASPVAKLADL
KGKRIAVSFGSDSHLDLLASLAEAGLDPKTDVELLNIQPAELPVALEKDHADAIVIRQPQ
VLRLQQSQGARLIKSWPHTYVVLARAAYLEKHPDAIRSLTGALADSVAYIRARPEQAAEW
FGEKLRVDAATVRQVSAENPLIASPHYYQLGVTPDLRAVTARWMTEAHKWGLIKSPVDAG
RLFLP