Protein Info for AMB_RS09345 in Magnetospirillum magneticum AMB-1

Annotation: Rrf2 family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 TIGR00738: Rrf2 family protein" amino acids 1 to 134 (134 residues), 114.4 bits, see alignment E=1.7e-37 PF02082: Rrf2" amino acids 2 to 134 (133 residues), 128.7 bits, see alignment E=8.2e-42

Best Hits

Swiss-Prot: 40% identical to Y2142_RHOCB: Putative HTH-type transcriptional regulator rrf2-like (RCAP_rcc02142) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: None (inferred from 100% identity to mag:amb1848)

Predicted SEED Role

"Rrf2 family transcriptional regulator" in subsystem Flagellar motility or Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W673 at UniProt or InterPro

Protein Sequence (149 amino acids)

>AMB_RS09345 Rrf2 family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MLSSKAKYGLKAMVHLARHEGLGPCLIADVAEAEHIPKKFLDAILLEMKNQGLLSSKKGK
GGGYVLARPAERIMVGDIVRILDGPLAPIPCVSRTAYRPCEDCLDEAACTVRAVMQDVRD
AIAAILDNTSLADMRVSKARAETVLMYDI