Protein Info for AMB_RS09295 in Magnetospirillum magneticum AMB-1

Annotation: carboxymuconolactone decarboxylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 61 to 103 (43 residues), 33.2 bits, see alignment 1.4e-12 PF02627: CMD" amino acids 61 to 104 (44 residues), 35 bits, see alignment 5.8e-13 amino acids 137 to 180 (44 residues), 24.9 bits, see alignment 8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1837)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W684 at UniProt or InterPro

Protein Sequence (211 amino acids)

>AMB_RS09295 carboxymuconolactone decarboxylase family protein (Magnetospirillum magneticum AMB-1)
MPPWSSPSGSGSGAILPQGNPGENMDCRGRSITSRNISSASSVQWALRPVQENAMPMTML
EKELVALAISVAAGCRPCVTHHLVEVRKAGADDAAIEQAVAGAVRVRKTATEGMRRHALG
LDPVTDGCGCGAADPLAELIALGAALAVNCTAGIDRHLAAARSLGIPQDRLDEVLGLASM
IRSRAISHAEARLGATGQGNWGEAPKAARCC