Protein Info for AMB_RS09275 in Magnetospirillum magneticum AMB-1

Annotation: arsenical pump-driving ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 PF02374: ArsA_ATPase" amino acids 8 to 291 (284 residues), 170 bits, see alignment E=3.4e-53 amino acids 327 to 466 (140 residues), 104.9 bits, see alignment E=2.2e-33 amino acids 457 to 553 (97 residues), 23.8 bits, see alignment E=1.1e-08 TIGR04291: arsenical pump-driving ATPase" amino acids 8 to 567 (560 residues), 771.3 bits, see alignment E=6.5e-236 PF13614: AAA_31" amino acids 10 to 158 (149 residues), 38.2 bits, see alignment E=6.5e-13 PF01656: CbiA" amino acids 10 to 195 (186 residues), 37.4 bits, see alignment E=1.1e-12 amino acids 328 to 375 (48 residues), 33.5 bits, see alignment 1.7e-11 TIGR00345: transport-energizing ATPase, TRC40/GET3/ArsA family" amino acids 12 to 290 (279 residues), 222.7 bits, see alignment E=7.8e-70

Best Hits

KEGG orthology group: K01551, arsenite-transporting ATPase [EC: 3.6.3.16] (inferred from 100% identity to mag:amb1833)

Predicted SEED Role

"Arsenical pump-driving ATPase (EC 3.6.3.16)" in subsystem Arsenic resistance (EC 3.6.3.16)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W688 at UniProt or InterPro

Protein Sequence (568 amino acids)

>AMB_RS09275 arsenical pump-driving ATPase (Magnetospirillum magneticum AMB-1)
MSLPQVETRILFFTGKGGVGKTSLSCATGLALAEAGRRVLIVSTDPASNLDEVLGATLSQ
VPTAIPGAPGLFALNIDPEAAARDYRERMVGPYRGILPAAAIASMEEQFSGACTVEIAAF
DEFAKLLGDPAATAEFDHVIFDTAPTGHTLRLLTLPSAWTEFIASSTGGASCLGPLAGLE
KQKALYAATVAQLADPKATTLVLVSRPERSALREAERTRGELAELGVSNLRLALNGVFTA
ASPGDAIADAMTERGRDALATMPAGLASLPRSDTPFLPRGTVGLDALRAMGQAGAAHPPG
FEPMPRIHLPGGLEALVAEIAASGHGVVMTMGKGGVGKTSVAAAIATALARLGHKVTLST
TDPAAHVQDAVEGKVAGLTVTRIDPEREVADYRDEVLAKAGGTLDMAGRAMLEEDLRSPC
TEEIAVFRAFSRTVDEGRDRFVILDTAPTGHTILLLDAAEAYHREVLRTQAEMPEAVRSL
LPRLRDRDFTKTIIVTLAEATPVHEAERLQDDLARAGITPFAWVINQSLLASGTRDPLLT
QRGTYEVPFIERVAANPSSRTALIPWTA