Protein Info for AMB_RS09270 in Magnetospirillum magneticum AMB-1

Annotation: arsenical resistance operon transcriptional repressor ArsD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 PF06953: ArsD" amino acids 1 to 123 (123 residues), 156.9 bits, see alignment E=1.4e-50

Best Hits

Swiss-Prot: 44% identical to ARSD2_ECOLX: Arsenical resistance operon trans-acting repressor ArsD (arsD) from Escherichia coli

KEGG orthology group: None (inferred from 100% identity to mag:amb1832)

MetaCyc: 42% identical to ArsD monomer (Escherichia coli)
RXN-22365

Predicted SEED Role

"Arsenical resistance operon trans-acting repressor ArsD" in subsystem Arsenic resistance

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W689 at UniProt or InterPro

Protein Sequence (123 amino acids)

>AMB_RS09270 arsenical resistance operon transcriptional repressor ArsD (Magnetospirillum magneticum AMB-1)
MTKLEVYDPAMCCSTGVCGPEVDPALVAFAADLKWVAEQGIAVQRYNLGTEPQAFAANPL
VLKEMEAGMDRLPIIAVDGHIIATGIYLTREQLAAKLGLTPSKPRITVKADGSSCCSPKT
GCC