Protein Info for AMB_RS09210 in Magnetospirillum magneticum AMB-1

Annotation: preprotein translocase subunit SecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details TIGR00810: preprotein translocase, SecG subunit" amino acids 6 to 73 (68 residues), 67.1 bits, see alignment E=5.6e-23 PF03840: SecG" amino acids 6 to 73 (68 residues), 63.9 bits, see alignment E=6.1e-22

Best Hits

Swiss-Prot: 34% identical to SECG_ECOL6: Protein-export membrane protein SecG (secG) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03075, preprotein translocase subunit SecG (inferred from 100% identity to mag:amb1820)

MetaCyc: 34% identical to Sec translocon subunit SecG (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit SecG (TC 3.A.5.1.1)" in subsystem Murein hydrolase regulation and cell death (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6A1 at UniProt or InterPro

Protein Sequence (112 amino acids)

>AMB_RS09210 preprotein translocase subunit SecG (Magnetospirillum magneticum AMB-1)
MDVFPIILVIHLILAVALVGVILLQRSEGGALGIGGGSGGGLMTGRAAGNLLTRTTAIVA
GSFFLTSLVLALLANSRTGGGSPFDKLNTPVAAPAAPVVPAEPAAPSAPLSR