Protein Info for AMB_RS09080 in Magnetospirillum magneticum AMB-1

Annotation: peptide-modifying radical SAM enzyme CbpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 TIGR04163: peptide-modifying radical SAM enzyme CbpB" amino acids 16 to 443 (428 residues), 777.5 bits, see alignment E=3e-238 PF04055: Radical_SAM" amino acids 84 to 250 (167 residues), 65 bits, see alignment E=1e-21 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 329 to 415 (87 residues), 52.1 bits, see alignment E=7.1e-18 PF13186: SPASM" amino acids 329 to 393 (65 residues), 27.1 bits, see alignment E=4.3e-10

Best Hits

KEGG orthology group: K06871, (no description) (inferred from 100% identity to mag:amb1795)

Predicted SEED Role

"Putative arylsulfatase regulatory protein" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6C6 at UniProt or InterPro

Protein Sequence (459 amino acids)

>AMB_RS09080 peptide-modifying radical SAM enzyme CbpB (Magnetospirillum magneticum AMB-1)
MNQAAPLRGGRLPDGLQTFEIGHADYTALIDADNAFWALVRKDEMERVLDNGALERDWRA
KREDFAREMDMLRFHLKPSAVYFNPTERCNLDCSYCYIPQTMRRSGEHMSRDRLMEAMAR
LDEYFSRTMPEGRKPQIIFHGAEPLLNRDAMFEAIDSYSDRFRFGVQTNATLLDAVTAEF
LTSRGCGIGLSLDAPTPEVADRSRKRWSGDGVFASTVDAIRRLKGYAGFNVICTMNRENL
GQLTEMVEFLHAEEVPACMLNVVRCTQPGGQDSWAEDQAVSKAYLAALDRSHQLYRETGR
KLVVANFVNILISILAPTARRLMCDISPCGGGRSFFALAPDGSLFPCSEFIGLPAFAGGN
LFTDTVEDVLESPAFKLVTGRKVEDIKACSTCPVRHFCGSPCPAEAHEANGGMEQIGAYC
GFYLDQAQYAFRLIADGIAEDYMWDGWDEGTETAFAFGC