Protein Info for AMB_RS08595 in Magnetospirillum magneticum AMB-1

Annotation: ankyrin repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1044 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF12796: Ank_2" amino acids 30 to 91 (62 residues), 34.1 bits, see alignment 1.3e-11 amino acids 84 to 153 (70 residues), 31.1 bits, see alignment 1.2e-10 amino acids 163 to 250 (88 residues), 55.6 bits, see alignment E=2.6e-18 amino acids 216 to 281 (66 residues), 37.4 bits, see alignment 1.3e-12 amino acids 256 to 315 (60 residues), 28.1 bits, see alignment 1e-09 amino acids 291 to 390 (100 residues), 34.2 bits, see alignment E=1.2e-11 amino acids 422 to 492 (71 residues), 40 bits, see alignment 1.9e-13 amino acids 627 to 693 (67 residues), 33.6 bits, see alignment 1.9e-11 PF13637: Ank_4" amino acids 32 to 81 (50 residues), 24 bits, see alignment 1.5e-08 amino acids 196 to 245 (50 residues), 32.6 bits, see alignment 3e-11 amino acids 434 to 483 (50 residues), 26.3 bits, see alignment 2.9e-09 PF00023: Ank" amino acids 61 to 91 (31 residues), 22.1 bits, see alignment (E = 5.8e-08) amino acids 194 to 220 (27 residues), 23 bits, see alignment (E = 2.9e-08) amino acids 430 to 461 (32 residues), 24.3 bits, see alignment (E = 1.2e-08) amino acids 463 to 494 (32 residues), 21.6 bits, see alignment (E = 8.4e-08) amino acids 636 to 661 (26 residues), 14.8 bits, see alignment (E = 1.2e-05) PF13857: Ank_5" amino acids 425 to 469 (45 residues), 35.6 bits, see alignment (E = 3.8e-12) amino acids 619 to 675 (57 residues), 38.4 bits, see alignment 4.8e-13 PF13606: Ank_3" amino acids 430 to 457 (28 residues), 20.2 bits, see alignment (E = 2.3e-07) PF13360: PQQ_2" amino acids 702 to 875 (174 residues), 73.2 bits, see alignment E=1.1e-23 amino acids 892 to 1044 (153 residues), 38.9 bits, see alignment E=3.1e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1695)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6M6 at UniProt or InterPro

Protein Sequence (1044 amino acids)

>AMB_RS08595 ankyrin repeat-containing protein (Magnetospirillum magneticum AMB-1)
MRKLGLALFFWVMAISTSAIAGWEPETPLPPLHRAAYDGDVVAVRRMLAAGTAVDARNDQ
GVTALMAAAGAGQLATISALLDAGADPNSRNIRGNTPLIFATVSSGETVNLLLGRGAAIN
DKGSEDRTPLDWALADENLATALSLLDHGADIKTIGRGGISFLHLAAKTGRNDLIRRFLA
AGLDVNYSTFKRVTPLHFASGEGHLESVRLLLEAGAKPGPTDANGEDPIAWAAENGHTAI
VQTLLNAGIDGRTATAALTAAVTKGHNDIVTLLLDRGAPIETRGFAHRPLLMLAAWSDMP
DTVTLLIDRGANVNAMMGEGQKPDGETVLIQASRWMTSADPIRRLLKAGADPGAIAKDGS
TTLMAACGNHKSVEPLRALLDAGIKVDASDNDGQNCFHAIGATGLLDATNLVSAKLLRVQ
KLVTAIDTRGYTPLHLAARYGKAAMAIRFLALGADIYARNRAGETPIYLAAENGDLATVQ
ALLDRHADPTQENKLFKYTPLMAAADRGKAKAFAALWQSMPWLWDLRNRERRRAAGRLLE
RLTENKDADIADIHLLLDGYSKFLEINDLAEAMKNAAKDGRSDIVRVLAASGAPLDHPKI
RSPLGTAVYGGHVETVRTLLELGAKVDFRSTDDGSRTPLMVAADKGRRELIDILLKAGAA
RGLKDSEGHTALDIAVTRGEVKVADALRHAGDIQTAPSRMAWRMVLNDHGLEFLGPMQGI
KDAVAIADGRVFTGSRNGYFYALDAGSGAVSWKKWLAGGVERAPAADGAAVYAVTQNNTL
FKLDAANGSVLWRFQYDHGGSPHTAPHLIDGGLVAFASSQRLYVIRRNDGTEAWSVEIPG
AGLGPADSMTVANGKAYISLSAGGIIAVDLARRTTALYRPPAETSFSAPEIGDGTVYATA
RDGFLYAIDATTLRLKWRQSLGEQALVRPLFHDGILYIPSRKWLFAVKPNDKEYDIVWTH
NLGVETYASPLWHDGKLYVCEGTSGLGGYALKAAISAIDPKTGNATWSHPLDSLNCVRNP
VTDGVHIFAPDAGHGGEVYALSVQ