Protein Info for AMB_RS08510 in Magnetospirillum magneticum AMB-1

Annotation: 5-aminolevulinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 63% identical to HEM1_RHIRD: 5-aminolevulinate synthase (hemA) from Rhizobium radiobacter

KEGG orthology group: K00643, 5-aminolevulinate synthase [EC: 2.3.1.37] (inferred from 100% identity to mag:amb1683)

MetaCyc: 58% identical to 5-aminolevulinate synthase 2 (Cereibacter sphaeroides)
5-aminolevulinate synthase. [EC: 2.3.1.37]

Predicted SEED Role

"5-aminolevulinate synthase (EC 2.3.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.3.1.37)

MetaCyc Pathways

tetrapyrrole biosynthesis II (from glycine) (4/4 steps found)
superpathway of heme b biosynthesis from glycine (6/8 steps found)
2-amino-3-hydroxycyclopent-2-enone biosynthesis (2/4 steps found)
superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6N8 at UniProt or InterPro

Protein Sequence (412 amino acids)

>AMB_RS08510 5-aminolevulinate synthase (Magnetospirillum magneticum AMB-1)
MDYEHYFTKRISDLKSEGRYRVFADLERQKGRFPIALNYRDGEVREVVVWCSNDYLGMGQ
HPEVIAAAHEALERCGAGAGGTRNISGTNHYHVLLEEELASFNAKESSLLFTSGYVANQT
TLSTLGATIPGCVVFSDELNHNSMIEGIRHGRSAKQVFRHNDPEHLEQLLSAYPKETPKL
VAFESVYSMDGDIAPIAEICDVAEAHNAMTYLDEVHAVGMYGAEGSGVAERDGVRDRITI
IQGTLAKALGVVGGYIAASASCVDYVRSFGPGFIFSSSMPPATAAAALASIRYLRAHPEI
RDRHQERAATAKRLLSARGIPVLPSVSHIVPVMVGNAALCKEASDLLLNEYGIYVQPINY
PTVPVGTERLRITPTPLHDDAMMAHLVDAFSAVWDRLDLHKVHHPKTIKAAE