Protein Info for AMB_RS08500 in Magnetospirillum magneticum AMB-1

Annotation: iron permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details PF03239: FTR1" amino acids 1 to 259 (259 residues), 122.6 bits, see alignment E=9.9e-40

Best Hits

KEGG orthology group: K07243, high-affinity iron transporter (inferred from 100% identity to mag:amb1681)

Predicted SEED Role

"InterPro IPR004923 COGs COG0672"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6P0 at UniProt or InterPro

Protein Sequence (269 amino acids)

>AMB_RS08500 iron permease (Magnetospirillum magneticum AMB-1)
MLASAVIVFREVLEAALIVGIVLAATKGLAGSRRWVTAGILAGLLGSAVIAGSAEALSDA
LSGMGQELFNASILGVAVLMLGWHTVWMSSHGREMAAEMKRVGHAVVVGARPLSVLAVVV
GVAVLREGAETVLFVFGISTAEEGGKMATIAGCAVGLGAGITVGTLLYRGLLAIPTRHLF
SVTTWLVTLLAAGMAAQAVTYLSAAGVIEMAPQPLWDTSWLLSETSIGGRLLHTLVGYMD
RPSAVQLLAYGATLLGITALARVAGRQHA