Protein Info for AMB_RS08485 in Magnetospirillum magneticum AMB-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01855: POR_N
  • amino acids 22 to 219 (198 residues), 155.9 bits, E=1.5e-49
• PF17147: PFOR_II
  • amino acids 275 to 378 (104 residues), 102.3 bits, E=1.7e-33

Best Hits

Swiss-Prot: 67% identical to PADG_AZOEV: NADH-dependent phenylglyoxylate dehydrogenase subunit alpha (padG) from Azoarcus evansii

KEGG orthology group: K00169, pyruvate ferredoxin oxidoreductase, alpha subunit [EC: 1.2.7.1] (inferred from 100% identity to mag:amb1678)

MetaCyc: 67% identical to phenylglyoxylate dehydrogenase (acylating) subunit PadG (Aromatoleum evansii)
Phenylglyoxylate dehydrogenase (acylating). [EC: 1.2.1.58]

Predicted SEED Role

"Pyruvate:ferredoxin oxidoreductase, alpha subunit (EC 1.2.7.1)" in subsystem Pyruvate:ferredoxin oxidoreductase (EC 1.2.7.1)

MetaCyc Pathways

• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• reductive TCA cycle I (9/11 steps found)
• incomplete reductive TCA cycle (6/7 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate VI (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• L-alanine degradation V (oxidative Stickland reaction) (2/2 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (7/9 steps found)
• pyruvate decarboxylation to acetyl CoA III (1/1 steps found)
• phenylacetate degradation II (anaerobic) (3/4 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• pyruvate fermentation to butanoate (5/7 steps found)
• pyruvate fermentation to acetate and alanine (2/3 steps found)
• pyruvate fermentation to acetate III (1/2 steps found)
• reductive monocarboxylic acid cycle (1/2 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• reductive TCA cycle II (8/12 steps found)
• pyruvate fermentation to ethanol III (1/3 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• isopropanol biosynthesis (engineered) (2/5 steps found)
• pyruvate fermentation to acetone (2/5 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• purine nucleobases degradation II (anaerobic) (15/24 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (4/9 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (4/9 steps found)
• L-glutamate degradation VII (to butanoate) (6/12 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (4/13 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (11/27 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Phenylalanine metabolism
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.1

Use Curated BLAST to search for 1.2.1.58 or 1.2.7.1

Sequence Analysis Tools

See Q2W6P3 at UniProt or InterPro

Protein Sequence (405 amino acids)

>AMB_RS08485 hypothetical protein (Magnetospirillum magneticum AMB-1)
MNKVSTGKVIVCDGNEAAAWGACLSRPDMVAVYPITPQSSLVEYLAQFIADGRMDADLMD
VEGEHTVLSVLHGAVLAGARTYSATSAQGLAFMFEPYFRTPGLRLPMVVSLVTRDAVSPT
CVWGGQQDAMTVKEVGWIHMYCETQQEILDTIPIAYKVAEHPDVMLPVNVNHDGNYLSYG
VARVELPDQSVVDAFLGEKQVNWHACLDPERPMAVDPLTGGAGGIGPSLFVKYRKGICAG
MQDALRIIEEAHEDWGRRTGRYWSPLIEEYRMEDAEVALVTIGSMTGAAKDAVDDARASG
KKIGLVKIKTFRPFPAARIAQALSRVKAVGVVDRSVNFGWNCGPVYQEVLAAMYAQPVRI
PMMSFIGGLAGADITVEHFAEVVHRTFRLAGGEAATGPVWLNEND