Protein Info for AMB_RS08400 in Magnetospirillum magneticum AMB-1

Annotation: ATP-sensitive inward rectifier potassium channel 10

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details PF01007: IRK" amino acids 14 to 134 (121 residues), 23.6 bits, see alignment E=6.3e-09 PF07885: Ion_trans_2" amino acids 59 to 129 (71 residues), 36 bits, see alignment E=8.1e-13 PF17655: IRK_C" amino acids 138 to 290 (153 residues), 100.2 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 89% identical to IRK10_MAGMG: Inward rectifier potassium channel Kirbac3.1 from Magnetospirillum magnetotacticum

KEGG orthology group: K08715, inward rectifier potassium channel (inferred from 100% identity to mag:amb1660)

Predicted SEED Role

"Putative ATP-sensitive potassium channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6R1 at UniProt or InterPro

Protein Sequence (291 amino acids)

>AMB_RS08400 ATP-sensitive inward rectifier potassium channel 10 (Magnetospirillum magneticum AMB-1)
MKPPVSRPRILNPDGSSNIARLGLEKRGWLDDHYHHLLTVSWPGFFAVIAGLYLMANALF
ALAYLACGDVIENARPGSFTDAFFFSVQTMATIGYGKLIPIGPLANTQVTLEALCGMLGL
AVAASLIYARFTRPTAGVLFSSCTVVTEFEGKPTLMMRLANLRVEQIIEADVHLVLVRSE
ISQEGMLFRRFHDLQLTRSHSPIFSLSWTIMHPIDHHSPLYGETAETLRHSHSELLVLFT
GHHEAFAQDVHARHAYSCDEIIWGGRFVDVFTTLPDGRRALDLTKFHEIAQ