Protein Info for AMB_RS08295 in Magnetospirillum magneticum AMB-1

Annotation: hydrogenase formation protein HypD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 TIGR00075: hydrogenase expression/formation protein HypD" amino acids 2 to 371 (370 residues), 484.1 bits, see alignment E=1.3e-149 PF01924: HypD" amino acids 12 to 369 (358 residues), 518.7 bits, see alignment E=3.9e-160

Best Hits

Swiss-Prot: 73% identical to HYPD_RHILV: Hydrogenase maturation factor HypD (hypD) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K04654, hydrogenase expression/formation protein HypD (inferred from 100% identity to mag:amb1639)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypD" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6T2 at UniProt or InterPro

Protein Sequence (379 amino acids)

>AMB_RS08295 hydrogenase formation protein HypD (Magnetospirillum magneticum AMB-1)
MKYIDEFRDGEVAQSIAQAIKAEADPGSTYHIMEFCGGHTHAISRYGLEDLLPANVRMIH
GPGCPVCVLPVGRIDAAIWLAKQPGVTLVTYGDMLRVPGSKRLSLLKAKAEGADVRMVYS
TLDAIKLAQANPDRQVVFFAIGFETTTPPTAVAIKQAQALDLKNFSVFCNHVLTPSAITQ
ILDSPEVRELGTVKLDAFIGPAHVSTIIGSRPYEYFAEEYQRPVVIAGFEPLDVMQAVRM
LVRQINDGRFEVENEFARAVTRDGNEKAKSLVADMFELRRAFEWRGLGLVPYSALRLKEP
YAAWDAERRWDVPQDSPPDNKACECGAILRGVKKPTDCKLFGTVCTPENPMGSCMVSAEG
ACAAHWTYGRFRDLETSHA