Protein Info for AMB_RS08170 in Magnetospirillum magneticum AMB-1

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 TIGR01035: glutamyl-tRNA reductase" amino acids 9 to 403 (395 residues), 310.3 bits, see alignment E=1.1e-96 PF05201: GlutR_N" amino acids 11 to 160 (150 residues), 137.5 bits, see alignment E=1.1e-43 PF01488: Shikimate_DH" amino acids 176 to 310 (135 residues), 107.6 bits, see alignment E=2e-34 PF13241: NAD_binding_7" amino acids 183 to 283 (101 residues), 27.3 bits, see alignment E=1.6e-09 PF03446: NAD_binding_2" amino acids 191 to 258 (68 residues), 22 bits, see alignment E=5.4e-08 PF03807: F420_oxidored" amino acids 192 to 266 (75 residues), 25.8 bits, see alignment E=4.6e-09 PF00745: GlutR_dimer" amino acids 324 to 413 (90 residues), 40.1 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 41% identical to HEM1_MAGMM: Glutamyl-tRNA reductase (hemA) from Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 100% identity to mag:amb1617)

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6V4 at UniProt or InterPro

Protein Sequence (415 amino acids)

>AMB_RS08170 glutamyl-tRNA reductase (Magnetospirillum magneticum AMB-1)
MSGVSHHLVVIGANHRSASLSLRDALFVDDAVAPAFLETLKRAGLPECLVLATCDRVEIW
AEDRDPVHAARLVAEALAARAGLEPAALLPHLYTLTGGEAVRHGFTVTSSLDSLVIGEPH
VTGQVKAAHRLARDAGCCGGELDHFLQAAFAAAKRVRSETSIGEGPVSIAAAAVQTARDV
HGDLAGLRALLVGTGEMGELVAESLLAAGLKDISVAAPRAARAEAVAKSLDGHVLAFEDL
RETLASFDVVLTCVGARTVSVTSEMVTNALRKRRRKPVFLVDAGIPGDIEPAVNRLDGAF
LYDLADLEKVALEGRATREAAARAAREIVEAEAQAFLRGRAARAAVPAIVALRARFDEAR
DLVLAEAGHDAAEATRLLINRLLHAPSEVMKDVASDGAEWRAMEKTLRILFRLDE