Protein Info for AMB_RS08145 in Magnetospirillum magneticum AMB-1
Annotation: 2-nitropropane dioxygenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K02371, enoyl-[acyl carrier protein] reductase II [EC: 1.3.1.-] (inferred from 100% identity to mag:amb1613)Predicted SEED Role
"Enoyl-[acyl-carrier-protein] reductase [FMN] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.9)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
- superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
- oleate biosynthesis IV (anaerobic) (13/14 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
- biotin biosynthesis I (13/15 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
- fatty acid elongation -- saturated (5/5 steps found)
- gondoate biosynthesis (anaerobic) (4/4 steps found)
- 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
- (5Z)-dodecenoate biosynthesis I (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
- cis-vaccenate biosynthesis (4/5 steps found)
- (5Z)-dodecenoate biosynthesis II (4/6 steps found)
- anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- streptorubin B biosynthesis (20/34 steps found)
- mycolate biosynthesis (20/205 steps found)
- superpathway of mycolate biosynthesis (21/239 steps found)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- Biosynthesis of unsaturated fatty acids
- Fatty acid biosynthesis
- Fluorene degradation
- Fluorobenzoate degradation
- Isoflavonoid biosynthesis
- Phenylalanine metabolism
- Propanoate metabolism
- Tryptophan metabolism
- gamma-Hexachlorocyclohexane degradation
Isozymes
Compare fitness of predicted isozymes for: 1.3.1.9
Use Curated BLAST to search for 1.3.1.- or 1.3.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W6V8 at UniProt or InterPro
Protein Sequence (349 amino acids)
>AMB_RS08145 2-nitropropane dioxygenase (Magnetospirillum magneticum AMB-1) MPEGLMDKARERLEHLWRRGREFLGTEYAIMGGAMSWISERQLVAAISNGGGFGVLACGS MGPGLLREEIRATQELTARPFGVNLITLHPDLDALIDVCGEMQVGHIVLAGGLPSAASIK RAKDTGAKVICFAPAVVLAKKLLRAGVDALVIEGAEAGGHVGPVATSVLAQEILPVIDQV PVFVAGGIGRGEAIVSYLEMGASGCQLGTRFVCASECIAHPNFKKAFIRAAARDALPSVQ VDPQFPVIPVRALSNNATRRFILFQMEVISRFKSGEIEQKDAQLEIEHFWAGALKRAVID GDVENGSLMAGQSVGMVTREQPTAEILQELLSQALAALADRHGPVPVQA