Protein Info for AMB_RS08130 in Magnetospirillum magneticum AMB-1

Annotation: DUF1275 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 64 to 88 (25 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details PF06912: DUF1275" amino acids 22 to 237 (216 residues), 147.5 bits, see alignment E=2.1e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1610)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W6W1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>AMB_RS08130 DUF1275 domain-containing protein (Magnetospirillum magneticum AMB-1)
MPIYFLRRLSGHRRTSSANKHLGYSLAFIAGAINAGGFLAVERYTSHMTGIVSSLADNLV
TNQLGAVLVGLGSLAAFIAGSAYSAILINWGRHHRTHSKYAYPLLWEAILLLCFGLMGGS
LELHESAFIPVTVMLLCFIMGLQNAIISKISNSEIRTTHMTGIVTDIGIELGKAFYLNSQ
KESAHYQPVRANKARLAVLASLLLSFLSGGVAGAVGFKYVGYASTIPLAVFLVFLAIVPL
VDDARTRFRVFTRHRMH