Protein Info for AMB_RS07975 in Magnetospirillum magneticum AMB-1

Annotation: nitrogen fixation protein NifZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 PF04319: NifZ" amino acids 12 to 83 (72 residues), 99.5 bits, see alignment E=3.6e-33

Best Hits

Swiss-Prot: 45% identical to NIFZ_RHOCA: Probable NifZ protein (Fragment) (nifZ) from Rhodobacter capsulatus

KEGG orthology group: K02597, nitrogen fixation protein NifZ (inferred from 53% identity to rru:Rru_A0997)

Predicted SEED Role

"NifZ protein" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (93 amino acids)

>AMB_RS07975 nitrogen fixation protein NifZ (Magnetospirillum magneticum AMB-1)
MSDGTHFELWDEPVYQRGDKVMALRDVRNDGTYPGSRIGEFLIRKGEWGYVSQVGTYLNR
FYVYSVDFVEARMLVGMRAHELKRIEEEERKAS