Protein Info for AMB_RS07795 in Magnetospirillum magneticum AMB-1

Annotation: DNA polymerase III subunit epsilon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family" amino acids 216 to 383 (168 residues), 107.9 bits, see alignment E=2.6e-35 PF00929: RNase_T" amino acids 220 to 377 (158 residues), 129.4 bits, see alignment E=2e-41

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 100% identity to mag:amb1543)

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W728 at UniProt or InterPro

Protein Sequence (412 amino acids)

>AMB_RS07795 DNA polymerase III subunit epsilon (Magnetospirillum magneticum AMB-1)
MEMPLRRMLLAAGDPHTIRHECAVISDAIKRVTKGYHAMLAGWWPMADINSTELLSFVAS
RLGEGMGATVVGLPVWLHGDSHSLVMAIESLIWRVADRSGATQFDLSGGSDDHGVWVEFA
WEGEVVEQAQLDRWLAQSLVALGGMTVKDVLEHHAGTDLIRDRREGGGALRIPMRKGVEQ
HGHGRQVLPGRPEFYDMTLLEQSRDTGAMGAQPLKSLTFVVFDTETTGLHPSQGDQIVSI
AGVRIVNGRILSGESFNRIVNPGRPIPAESIRYHGITDDMVVDKPPAGVVLPQFRSYVAD
AVLVAHNAAFDLKFLRMREKDMGIRFDIPVLDTMILSNFLDGPDAGHSLDDICDRYGIEI
TDRHTALGDAMVTAAVLLRQIEALEGRGIQTLDQAVKTLDIAMILHERQRVL