Protein Info for AMB_RS07780 in Magnetospirillum magneticum AMB-1
Annotation: phosphoribosylformylglycinamidine synthase subunit PurS
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to PURS_BACSU: Phosphoribosylformylglycinamidine synthase subunit PurS (purS) from Bacillus subtilis (strain 168)
KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 99% identity to mag:amb1540)MetaCyc: 53% identical to factor required for phosphoribosylformylglycinamidine synthetase activity (Bacillus subtilis subtilis 168)
Phosphoribosylformylglycinamidine synthase. [EC: 6.3.5.3]
Predicted SEED Role
"Phosphoribosylformylglycinamidine synthase, PurS subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
- 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
- superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
- 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 6.3.5.3
Use Curated BLAST to search for 6.3.5.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2W731 at UniProt or InterPro
Protein Sequence (80 amino acids)
>AMB_RS07780 phosphoribosylformylglycinamidine synthase subunit PurS (Magnetospirillum magneticum AMB-1) MKAKVHITLKNGVLDPQGKAVQHALGSLGFGGVNDVRQGKYIELDLAETDKAKAKDAVEQ MCKGLLANTVIENYSIELVD