Protein Info for AMB_RS07755 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 TIGR00229: PAS domain S-box protein" amino acids 37 to 149 (113 residues), 29.2 bits, see alignment E=8.9e-11 amino acids 150 to 275 (126 residues), 97.3 bits, see alignment E=7.1e-32 PF13188: PAS_8" amino acids 154 to 199 (46 residues), 30.6 bits, see alignment 5.8e-11 PF00989: PAS" amino acids 154 to 266 (113 residues), 48.6 bits, see alignment E=2e-16 PF08448: PAS_4" amino acids 161 to 271 (111 residues), 27.6 bits, see alignment E=7.4e-10 PF13426: PAS_9" amino acids 165 to 268 (104 residues), 53.2 bits, see alignment E=7.9e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 277 to 438 (162 residues), 157.4 bits, see alignment E=2.7e-50 PF00990: GGDEF" amino acids 280 to 436 (157 residues), 170.5 bits, see alignment E=6.2e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1535)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W736 at UniProt or InterPro

Protein Sequence (459 amino acids)

>AMB_RS07755 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MLTTPHHSTDDLSTIVVGGNVPSSAAAAQAGNTAVDRELLELVSALVCILRQGEVVFINQ
AGVKVLGLASQADALGMAFVEFVESDYRFLVDAGWELLAEEEFLPLKLMRRDGSLFEAEI
RVRVIPGPEEQFLLEARDISKFVKSAEALREREERLQGVLASVAEGIITVDERGLIESAN
PAAERMFGHGKGKLVGQHIGVLMGPEQREHHQEMFGQYLSGSAKLMGRSVESMGYRADGG
RFPMEISVSELRYGKGRLFTGILRDISERKENEERIKRLAHHDTLTGLPNRNLLNDRISH
ALARVRRHGGRMAVLYVDLDKFKPINDTLGHEAGDAVLKEVARRLDNCVRSSDTVSRVGG
DEFVVVVEEIGRPGEAAMVARKIIEALGTPVPYEDHSCLVGASIGIAVFPDDGNTMEEVS
KAADVAMYRVKNSGRNGYCFYSDSMPVDDIDLAELPAGA