Protein Info for AMB_RS07735 in Magnetospirillum magneticum AMB-1

Annotation: histidine phosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF00300: His_Phos_1" amino acids 3 to 187 (185 residues), 137 bits, see alignment E=3.4e-44

Best Hits

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 100% identity to mag:amb1531)

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W740 at UniProt or InterPro

Protein Sequence (194 amino acids)

>AMB_RS07735 histidine phosphatase family protein (Magnetospirillum magneticum AMB-1)
MTVFLVRHGQSEGNRDLVFSGLSDHPLTELGRAQAAEAGWSLRGLNFAHVLTSRLSRAVA
TCDLLLAAAGSEVGRRRALEQLNERNFGVFEGVADDPATLAADPLRGRVASDVAYRPEGG
ESMLDCLERAVACFEGDILPLAADGHVLVVSHGNVVRSLALHHLGWPVEMLPEMPSRNCL
ITRIEPAGWVRSAR