Protein Info for AMB_RS07715 in Magnetospirillum magneticum AMB-1

Annotation: deoxycytidine triphosphate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF22769: DCD
  • amino acids 4 to 156 (153 residues), 119.9 bits, E=5.3e-39
• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 6 to 183 (178 residues), 167.6 bits, E=1.2e-53

Best Hits

Swiss-Prot: 100% identical to DCD_MAGSA: dCTP deaminase (dcd) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 100% identity to mag:amb1527)

MetaCyc: 73% identical to dCTP deaminase (Rickettsia prowazekii Madrid E)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See Q2W744 at UniProt or InterPro

Protein Sequence (184 amino acids)

>AMB_RS07715 deoxycytidine triphosphate deaminase (Magnetospirillum magneticum AMB-1)
MSVMPDTWIREMAKTKGMIEPFTEKQQRAGVISYGVSSYGYDARVSREFKIFTNVDSAVV
DPKSFSPNSLVDRETDICVIPPNSFALARTVEYFRIPRDVLVICLGKSTYARCGIIVNVT
PLEPEWEGHVTLEFSNTTPLPAKIYAGEGACQFIFLKGDTVCETSYADRSGKYQGQQGVT
LPRL