Protein Info for AMB_RS07510 in Magnetospirillum magneticum AMB-1

Annotation: CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 175 to 187 (13 residues), see Phobius details PF02515: CoA_transf_3" amino acids 5 to 377 (373 residues), 451.4 bits, see alignment E=1.3e-139

Best Hits

Swiss-Prot: 45% identical to SUCHY_HUMAN: Succinate--hydroxymethylglutarate CoA-transferase (SUGCT) from Homo sapiens

KEGG orthology group: None (inferred from 100% identity to mag:amb1487)

MetaCyc: 65% identical to succinyl-CoA-glutarate CoA-transferase (Pseudomonas putida)
Succinate--hydroxymethylglutarate CoA-transferase. [EC: 2.8.3.13]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W784 at UniProt or InterPro

Protein Sequence (401 amino acids)

>AMB_RS07510 CoA transferase (Magnetospirillum magneticum AMB-1)
MTGALSHLRILDLSRVLAGPWAGQLLADMGAEVLKIEKPGEGDDTRAWGPPFLDADEGRG
ESAYYLSANRGKHSVTIDFTQPQGQALVRRLVAQCDVVLENFKVGGLAKYGLDYDSLKAI
KPDLVYCSITGFGQDGPYAQRAGYDFLVQGMGGLMSLTGTPDGEPMKVGVALTDIFTGMY
AGFAVLAALAHRDRTGEGQHIDLALLDVQVAVLANQATNYLVGGVIPKRLGNSHPNIVPY
QAFATAEGHIILAIGNDAQFRRFCEVAGHPELGTDPLYATNADRVRHRAILVPVLVEIMT
EHDADYWIAELEKAGVPCGPINSLDRVFADPQVKHRGMAVAMEHPQREDLRLVANPIHLS
KTPVTYDRPPPLLGADTDDVLARLLGLDEGERAELRSSGVI