Protein Info for AMB_RS07235 in Magnetospirillum magneticum AMB-1

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 631 PF00072: Response_reg" amino acids 8 to 120 (113 residues), 62.1 bits, see alignment E=1.1e-20 amino acids 394 to 502 (109 residues), 77.7 bits, see alignment E=1.5e-25 PF00512: HisKA" amino acids 150 to 214 (65 residues), 68.3 bits, see alignment E=9.5e-23 PF02518: HATPase_c" amino acids 261 to 375 (115 residues), 94.8 bits, see alignment E=9e-31 PF01627: Hpt" amino acids 543 to 619 (77 residues), 33.6 bits, see alignment E=7.5e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1432)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7D9 at UniProt or InterPro

Protein Sequence (631 amino acids)

>AMB_RS07235 signal transduction histidine kinase (Magnetospirillum magneticum AMB-1)
MNVPPIRVLLLEDDPADAKLVGQMLRRVKTTPFEVTVVGRLAQAVERLSEGPQSFDVVLA
DLGVPDSSGIGTLNALTRVAPRLPVVVLTGNDDDAVALEALKRGAQDYLVKGLGDAFILS
RVVRYAIERKMGEEVLREARDSAEQAARAKSVFLAMMGHEIRTPLNGVLGMARLLLETDL
DPRQKSFAETLVSSGELLLGLVNDILDFSRLDAEGMTLAVEPFDVLDTVEEVRLVLASRA
AEKDLALSCRFGAGVRRVVSGDRLRLRQILFNLVGNAIKFTDRGGVEIGVEPLAVEQGQI
LRFSVKDSGIGIAPEIGAQLFTEFWQGDSGAARRFDGAGLGLAICKRLTDLMGGVIGYDS
LPDRGSTFRVDLPLPPAESPLAEQSGGSERPCRVLLVDDNEVNREVAAGLLQRRGHHVVC
ACDGHEGVEAAARGGFDLVLLDMRMPGMDGIDTARAIRALPGEAAKVPLYLLTANPVKED
EARWREAGILGCLAKPFRFDHIGHLLSGSDAAPRASAQDTDLVEVAGLLSDMGDLGRDRM
VGLVELFRTSSAADLAALADHAQAGRLAEAGQLAHRMASAASSLHLSPLAAKCRAVEDAA
RSEDPETMARAEELADLWARSLAAVGRVFDL