Protein Info for AMB_RS07175 in Magnetospirillum magneticum AMB-1

Annotation: ATP-dependent helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 transmembrane" amino acids 470 to 488 (19 residues), see Phobius details PF00580: UvrD-helicase" amino acids 13 to 276 (264 residues), 193.6 bits, see alignment E=1.5e-60 PF13245: AAA_19" amino acids 20 to 262 (243 residues), 74.3 bits, see alignment E=2.7e-24 PF13361: UvrD_C" amino acids 285 to 414 (130 residues), 43.6 bits, see alignment E=7.2e-15 amino acids 485 to 563 (79 residues), 69.7 bits, see alignment E=8.7e-23 PF13538: UvrD_C_2" amino acids 506 to 560 (55 residues), 45.5 bits, see alignment 1.4e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1417)

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA" in subsystem DNA repair, bacterial UvrD and related helicases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7F4 at UniProt or InterPro

Protein Sequence (637 amino acids)

>AMB_RS07175 ATP-dependent helicase (Magnetospirillum magneticum AMB-1)
MSEPAPPAAESPLDPEQRLAAEAEADSVLVLAGPGTGKTTTLVGRYVHLLEQGAAPARIF
VSTFTARAAEELRGRIGARLETRGGDFDAERFRRMPIGTLHGMALRLLQRHPPPGCPRFR
VFDEQACSRVIARHRLYLGDDVRKPTDVFGAYKDRLMSPAAALAEAKVRNDATLVEAAEA
YGRYQRALAEEGGFDFGDLIMELVRGLEEDEAYRARIAGFFDHLLIDEYQDINPAQERML
RLLRSEGARLWAVGDDDQCLYAWRSADPAFILGFETAWPDPALFRLSRNYRSSATIVNAA
GALIGANRRRHAKDQVPHSASRLALTIAGLDDDEDEADYVLRVVKGLSGRGMPWNEMAVL
YRAGHVGSRIQIRLAEAGIPLVVRGAGEFWQLGPVRLTAGLARLLSNPQDMDARAMLGHG
KRVDKLLQQAPEKIDADVPWPALCRQVGRLVSATARPPGEEGLQWRDLAFTAADLAAECG
TVAAFIALMEEQRRSLRRAESGGDAVVLSTIHGAKGLEWSAVVVAGCEADLMPHESSPDL
EEERRLMYVAATRAKRWLVLSFAAERRKAVAPSPYIAEMLSGLDEDQIRYHDPQSRARLH
AGPPQPVKADGPLRLRPELKVSSGMRKGRAPSKRTRF