Protein Info for AMB_RS07110 in Magnetospirillum magneticum AMB-1

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF13404: HTH_AsnC-type" amino acids 1 to 45 (45 residues), 32.7 bits, see alignment E=1.1e-11 PF22451: NirdL-like_HTH" amino acids 5 to 50 (46 residues), 51.8 bits, see alignment E=1e-17 PF17805: AsnC_trans_reg2" amino acids 67 to 139 (73 residues), 54.5 bits, see alignment E=2.1e-18

Best Hits

Swiss-Prot: 51% identical to NIRG_PSEST: Protein NirG (nirG) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 100% identity to mag:amb1405)

MetaCyc: 54% identical to siroheme decarboxylase NirG subunit (Paracoccus pantotrophus)
RXN-15805 [EC: 4.1.1.111]

Predicted SEED Role

"Heme d1 biosynthesis protein NirG" in subsystem Dissimilatory nitrite reductase or Heme biosynthesis orphans

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.111

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7G6 at UniProt or InterPro

Protein Sequence (147 amino acids)

>AMB_RS07110 Lrp/AsnC family transcriptional regulator (Magnetospirillum magneticum AMB-1)
MDDIDRAIINTLQGGFPICDRPFDAVAETLGLTGTQLRTRIGKLKADGIISRFGPMWHAE
RMGGELTLSAMKVPPERFDEVAGIVNAFPEVAHNYAREHALNMWFVVATEKPGRKAEVLA
EIETMTGITVHDMPKIQEFYVGLRFEA