Protein Info for AMB_RS07090 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome C556

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 27 to 97 (71 residues), 45.5 bits, see alignment E=3.8e-16

Best Hits

Swiss-Prot: 46% identical to NIRC_PSEAE: Cytochrome c55X (nirC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 52% identity to pgv:SL003B_0574)

Predicted SEED Role

"Cytochrome c55X precursor NirC" in subsystem Dissimilatory nitrite reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>AMB_RS07090 cytochrome C556 (Magnetospirillum magneticum AMB-1)
MTGAVVSVLVAWPLAAAAEISPGRQAKLRDMVDQDCGSCHGMTRQGGLGSPLLQEDLVKL
SAEAVVETILEGRPGTPMPPWKFMLSREEAAWIAAYLMGELK