Protein Info for AMB_RS07075 in Magnetospirillum magneticum AMB-1

Annotation: cytochrome c-552 precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details PF03264: Cytochrom_NNT" amino acids 23 to 184 (162 residues), 232.8 bits, see alignment E=4.3e-73 PF09459: EB_dh" amino acids 313 to 534 (222 residues), 78.7 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1398)

Predicted SEED Role

"Cytochrome c-type protein NapC" in subsystem Nitrate and nitrite ammonification or trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7H3 at UniProt or InterPro

Protein Sequence (552 amino acids)

>AMB_RS07075 cytochrome c-552 precursor (Magnetospirillum magneticum AMB-1)
MATESLLGKLLRMKILGASLFGAAVIFVGGIMFWGAFNTAMEATNTLGFCINCHEMKDNV
YQEYVKTVHYTNRSGVRAACSDCHVPKDWVHKFVRKIQASGEVFHWLMGSVNTPEKFDAK
RFQLAKRVWATMKSTDSRECRNCHAFDQMNPAVQKQRAKKQHENAQAEGGTCIDCHKGIA
HKPVHHLLEQEEEQKAAEAAKQKAEADAKKPAATAAAPASAPAAAPAPAAAPVAGGAQLP
PVTGKAVDWSKVAETKTVLFYPGQTAMEWILTGTDHGGTRAFKKGDRCFECHSNETADMG
AKMVSGAKAEKTPIPGKRAAIPLSVKAAYDADNLYMRFEFPAGPHNEVPFAKGGKMDPEN
EVKVAMMIDNGKVDMAARSGCWTSCHSDARDMPTAPAAGSLGTAKGIDTSHGYVTKYVPE
SRTQFDTTKRDNWDKVKPQAELDALLAGGTFLDLTRWKSSGVSEQGYVLAERVLKPGNDV
AYSGKKEGDKWVVTMVRRLKATQPGEANLVAGQSYSVGFAVHDDFTSGRFHHVSIDLKLG
LDAEGEIKAVKM