Protein Info for AMB_RS07040 in Magnetospirillum magneticum AMB-1

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 60 to 81 (22 residues), see Phobius details PF01435: Peptidase_M48" amino acids 102 to 284 (183 residues), 91.3 bits, see alignment E=2.2e-29 PF23914: TPR_CcmH_CycH" amino acids 351 to 456 (106 residues), 47.3 bits, see alignment E=6.4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1391)

Predicted SEED Role

"Putative Zn-dependent protease, contains TPR repeats"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7I0 at UniProt or InterPro

Protein Sequence (515 amino acids)

>AMB_RS07040 peptidase (Magnetospirillum magneticum AMB-1)
MAARGSSTATMPPKPVIWPTWPTGRAGSPQADSASSTVAAATGRADLRPRNELTDEERSL
LTRIILLVTFLLVASMPPALAQSQPRRQFIRDAEVENTIRTFGTPIFQAAGLDPAAVRIN
LIIDPTLNAFVAGGQNIFFHTGLLVRSEHPGQLIGVMAHETGHIAGGHLIRSTEAVANAS
TEAILATLLAAAAGAATGRGDVGMAGALGGNELAMRNLLAFSRSQESQADQMAMRFLDST
HQSGKGLLEFFDILGDQEALVSSRQDPYVRTHPLTRDRVSFVRSQVDQSPWSKTPWSPEW
IEMHRRMKAKLFAFIEPPIRTFQRYKEADTSIEARYARAIAAYRKPDLVMALGLIDGLIK
ERPNDPYFWELKGQMLFENGRGPEAIEPYRKAVKLLPDSALLRIALGQVLIESEDQSLLT
EAENHLTAAVNREPEDVFAWQQLAIAFARDGKEGMASYALAEHYMLAGKLSESLFHANKA
EQLLGKQGSIWLRIQDIKERASQVKADRDRARKWW