Protein Info for AMB_RS06965 in Magnetospirillum magneticum AMB-1

Annotation: PLP-dependent aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details PF00392: GntR" amino acids 84 to 145 (62 residues), 52.1 bits, see alignment E=4.1e-18 PF00155: Aminotran_1_2" amino acids 224 to 483 (260 residues), 90.1 bits, see alignment E=1.7e-29

Best Hits

KEGG orthology group: K00375, GntR family transcriptional regulator / MocR family aminotransferase (inferred from 100% identity to mag:amb1376)

Predicted SEED Role

"Predicted transcriptional regulator of pyridoxine metabolism" in subsystem Pyridoxin (Vitamin B6) Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7J5 at UniProt or InterPro

Protein Sequence (547 amino acids)

>AMB_RS06965 PLP-dependent aminotransferase family protein (Magnetospirillum magneticum AMB-1)
MHDRASSRMAAMASKSWLPRWGRWRKVVRSVLADMVALLSYSDWAESGSLKRSTSFIIME
PLPESAMPPPLPLALPDLDAPLHRRLYLALRDSILDGRLAEGAALPSSRGLAAQLGVARN
TVLAAYDLLAAEGFTEAHRGSATRVAARHPLVGAAPAGEEAPPSPLPPRTRAWGAAPPMI
LVRDPFRPFAPGVPDLAAFPHAEWRRVLGRLWRRPPLELMGGIDPLGHAPLRHAIAEHLG
RSRAVRCDPAQVMIMGGSQQALDLVARVLLEPGEAVLVEDPCYGGLTGVLRAAGAQVQAV
AVDGQGFDPELAERQCPSARLTFVTPSHQFPTGATMPLSRRLALIHWAERVGGWVIEDDY
DSDFHHAGSPTASLQGLDRGGRTLYLGTFSKSMFPGLRLGWLVVPPPLLPAFVAARRIAD
MAPAGLTQAAMAAFMTEGHFGAHLRRMRTLYGQRRRALLDAAPRILGPNLPVTAGEAGLH
AILWLPAGCDDFQAAEAARARGLAPSPLSFHRVTKGCPGLVLGYGNLAGSSLEEALQRLR
EAIITLI