Protein Info for AMB_RS06950 in Magnetospirillum magneticum AMB-1

Annotation: phosphate ABC transporter, permease protein PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 212 to 241 (30 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details PF11812: DUF3333" amino acids 19 to 166 (148 residues), 160.2 bits, see alignment E=4.2e-51 TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 192 to 431 (240 residues), 219.4 bits, see alignment E=2.6e-69 PF00528: BPD_transp_1" amino acids 232 to 433 (202 residues), 57.9 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 100% identity to mag:amb1373)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7J8 at UniProt or InterPro

Protein Sequence (434 amino acids)

>AMB_RS06950 phosphate ABC transporter, permease protein PstA (Magnetospirillum magneticum AMB-1)
MTEMAEITVAARTAETVAARLGRRYAAERRFRILGLASILISAGFLVLLLGTVVAKGWTG
FLQTQIAVEVSFDAEVIDPDGTRAPDVLDAADYPALVRNGLAARLVPDGDRSARRDLSAL
VSTMGAEQMRRMVAADPKVIGTRTTLWLTASDKLDMVYKGQAPREVGAAGNVLNDRQLGW
LAQLEQAGQIRKAFNLQFFTGGDSRAPEQAGIWGAVVGSFFSLAVTLLISFPLGVATAVY
LEEFAAKNRWTDLIEVNINNLAAVPSVVFGLLGLAVFLNVFHLPRSSPVAGGLVLALICL
PTIIIAGRAALKAVPPSIRQAAAGLGASPLQIVAHHVLPLAMPGMLTGTILGMARALGET
APLLMIGMVAFIVDIPKSPLDPSAVLPVQIYLWAGSSERAFVEKTSAAIMVLLLFLVAMN
MAAIWLRNKFERRW