Protein Info for AMB_RS06935 in Magnetospirillum magneticum AMB-1

Annotation: phosphate regulon transcriptional regulatory protein PhoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 TIGR02154: phosphate regulon transcriptional regulatory protein PhoB" amino acids 13 to 235 (223 residues), 348.5 bits, see alignment E=6.6e-109 PF00072: Response_reg" amino acids 14 to 126 (113 residues), 114.9 bits, see alignment E=2.1e-37 PF00486: Trans_reg_C" amino acids 159 to 234 (76 residues), 93 bits, see alignment E=9.6e-31

Best Hits

Swiss-Prot: 60% identical to PHOB_RHIME: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07657, two-component system, OmpR family, phosphate regulon response regulator PhoB (inferred from 100% identity to mag:amb1370)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7K1 at UniProt or InterPro

Protein Sequence (240 amino acids)

>AMB_RS06935 phosphate regulon transcriptional regulatory protein PhoB (Magnetospirillum magneticum AMB-1)
MTARETANPSKPLVLVVEDEAALATMLRYNLEKEGYRVAEAADGEEALTVLAERKPDLVL
LDWMLPSLSGIEICRQIRRKPATRELPIIMLTARGEEGDKIRGLNTGADDYLTKPFSLPE
LMARVRALLRRAQPVSQKGQISWGDVSMDLASHRVVRAGKAIHLGPTEFRLLQFFLQHPG
TVFSREELLDAVWGPDIYVEPRTVDVHIRRLRKALNCDTEADIIRTVRAAGYALDNEDAA