Protein Info for AMB_RS06820 in Magnetospirillum magneticum AMB-1

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 17 to 36 (20 residues), see Phobius details amino acids 274 to 290 (17 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 327 to 494 (168 residues), 170.7 bits, see alignment E=1.1e-54 PF00990: GGDEF" amino acids 331 to 490 (160 residues), 162.6 bits, see alignment E=7e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1345)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7M6 at UniProt or InterPro

Protein Sequence (498 amino acids)

>AMB_RS06820 GGDEF domain-containing protein (Magnetospirillum magneticum AMB-1)
MSRKGARSSRRVSQSPAILYSALFAILAGVAAWLGVDLAEGRGRIVAERTVLAVQKSQFM
AQWFGTTIISVDYVLRDVIGQTGPEVLRPRLDPERGRQLNGMLAEKTASVPRLTGISIYN
SDCVFVAAADTRLLGFRSNQKSCAERPEALTDKTYIQYVPAEKSASRRPVILVSRHLLSA
DGKLLGGALAAIDLSHAQDWISSFTVEDRDVLAIVDGDGVLLARNPELPAVIGTRTPQPT
GQPSFGEQRSSASFVAVSPLDGRERIFGLSKLENIPLILMVGYDLAGILTEWSKRAGQLA
AGFLLLVALATLGLRSYLTTVRQREELRRQADTDPLTGVPNRRHLMSVAEHELARTLRYG
GALALFMVDIDHFKAINDTWGHPTGDRVIQVLAAAMAASAREQDTAGRLGGEEFAAVLPE
TDLEGAAIMAERLREAVEAITSALDDQGQPVRFTVSIGVAAIQLGDGSVEDILGRADRAL
YAAKHGGRNRVEMAATAE