Protein Info for AMB_RS06780 in Magnetospirillum magneticum AMB-1

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 60 (24 residues), see Phobius details PF00512: HisKA" amino acids 90 to 153 (64 residues), 29.7 bits, see alignment E=5.6e-11 PF02518: HATPase_c" amino acids 198 to 309 (112 residues), 80.5 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1336)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7N5 at UniProt or InterPro

Protein Sequence (323 amino acids)

>AMB_RS06780 two-component sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MVLVLFWLSLGFDNGIERQFSSVPAAPAVDGGRVGSLLVAVLGPLGGGVLLLLLVQVVCW
QRRTAERLRLKEVELTEQRDRLRRYVADLERIADVAAHDLQEPLRRMVSYSQLLASHDQA
GCDDEVRDYVGHVVDGARRMRALVSGLREFVAVDSLPRTGEVSSAWVAMTVARQRLADKL
ADAGVTLVVDPLPEVEADPASLVEIFVQLLDNAARYRAPGRRPVVHVSVVRDGDMAKFQV
CDNGMGIDPARVVRMFEIFYRPHGGDGRAAPGVGTGLAVVRRLVERLGGAVWVESENGVG
STFGFSLRLGLSLPDRGREDKAA