Protein Info for AMB_RS06735 in Magnetospirillum magneticum AMB-1

Annotation: sulfonate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 98 to 125 (28 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 341 to 365 (25 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 411 to 435 (25 residues), see Phobius details amino acids 446 to 467 (22 residues), see Phobius details amino acids 488 to 509 (22 residues), see Phobius details amino acids 546 to 565 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 251 (166 residues), 48.5 bits, see alignment E=4.5e-17 amino acids 393 to 564 (172 residues), 47.1 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to mag:amb1325)

Predicted SEED Role

"ABC-type anion transport system, duplicated permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7P6 at UniProt or InterPro

Protein Sequence (579 amino acids)

>AMB_RS06735 sulfonate ABC transporter permease (Magnetospirillum magneticum AMB-1)
MRWSLPTVAVAPELKPNFWDLAIIPIIFALLALLAYGGAQMTTPYDVGEKLALSLDPAGL
PYYLLRSALRMAAALLASLIFTLIYASLAAKVPALEKVLIPILDILQSIPILGFLSITVT
GFIALFPGNLLGVECAAIFAIFTSQAWNMTFSLYSSLKTVPNDLIEASEMFHLSPWQRFW
RLELPWAMPGLVWNMMMSVSGGWFFVVASEAISVSGQSIALPGVGSYIALAIAEENLAAI
GWAMLAVLAGIMIYDQLMFRPLVAWADKFKVDSAPGEQQPESWLLTLMQRGRLFRYLARL
PSAAWDRFTFLLRQREETTLFHHAPIRMVTLPSWAERVWDGLLILAALGALVEVGLFIHG
AIGLWEVWQVLLYGLTTALRVVVLISLASLIWVPVGVWIGQRPLVAQNVQWVAQFLAAFP
ANLMFPVAVVLIVHFDANVDVWTSPLMILGTQWYILFNVIAGASAIPQDMKDAAGNLGLS
GWLRWKKFILPAIFPSYVTGAVTASGGSWNASIVSELVSWGDTKLEAVGLGSYIARATAD
GDFPRIALGIAVMCLFVMGFNRFLWRRLYMLAADRLRLD