Protein Info for AMB_RS06520 in Magnetospirillum magneticum AMB-1

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 TIGR00738: Rrf2 family protein" amino acids 1 to 128 (128 residues), 87.7 bits, see alignment E=3.1e-29 PF02082: Rrf2" amino acids 3 to 128 (126 residues), 95.5 bits, see alignment E=1.5e-31

Best Hits

Swiss-Prot: 41% identical to NSRR_BACHD: HTH-type transcriptional regulator NsrR (nsrR) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: None (inferred from 100% identity to mag:amb1282)

Predicted SEED Role

"Nitrite-sensitive transcriptional repressor NsrR" in subsystem Nitrosative stress or Oxidative stress or Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7T9 at UniProt or InterPro

Protein Sequence (128 amino acids)

>AMB_RS06520 transcriptional regulator (Magnetospirillum magneticum AMB-1)
MKITQFTDFSIRLLIYLSRHPDRVVTVREVAEYYDISAEHLKKIVRSLAELGHIQTVRGK
HGGLRLGREPQAIDLGHLFRQQENLALLPCHEPCDSCPIADCRLRGLVDSALAAFLAVFD
GKTLADVI