Protein Info for AMB_RS06515 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain S-box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 831 TIGR00229: PAS domain S-box protein" amino acids 29 to 153 (125 residues), 65.6 bits, see alignment E=4.7e-22 PF13188: PAS_8" amino acids 33 to 76 (44 residues), 28.4 bits, see alignment 5.3e-10 PF00989: PAS" amino acids 33 to 143 (111 residues), 47.3 bits, see alignment E=8.7e-16 PF08448: PAS_4" amino acids 39 to 148 (110 residues), 35.9 bits, see alignment E=3.5e-12 PF13426: PAS_9" amino acids 44 to 145 (102 residues), 49.1 bits, see alignment E=2.7e-16 PF08447: PAS_3" amino acids 54 to 139 (86 residues), 30.6 bits, see alignment E=1.5e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 156 to 316 (161 residues), 138.6 bits, see alignment E=1.6e-44 PF00990: GGDEF" amino acids 158 to 313 (156 residues), 164.1 bits, see alignment E=1.1e-51 PF00563: EAL" amino acids 334 to 569 (236 residues), 252.9 bits, see alignment E=1.2e-78 PF00072: Response_reg" amino acids 601 to 721 (121 residues), 65.3 bits, see alignment E=2.6e-21 PF01627: Hpt" amino acids 752 to 813 (62 residues), 28.3 bits, see alignment 7.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1281)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7U0 at UniProt or InterPro

Protein Sequence (831 amino acids)

>AMB_RS06515 PAS domain S-box protein (Magnetospirillum magneticum AMB-1)
MQPFFGGTVVEAKGKSPQRRVEELSQQVERLSLYQAVFDNAFEGMFATDAANRIIAVNPA
FTAITGYAAEEAIGNDPRMLSSGFHDPAFYQEMWDQLSTTGQWQGEVVDRHKDGRPVRLW
LSITSQRGADGKVARRIAVFRDVTEARETAEQLWQRSNFDPLTELPNRNLFLDRLLQALV
LAGREGSKVAMLFIGLDGFKNINDSLGHWIGDKVLQEAARRFQNCLRQGDTAARFGGDEF
TVVLSGVRATAEVEAVIRSVLEVLQEPFVVEHHHILISCSIGVCMWPGDGEDVDSLMRNA
TAALQQAKQAGRNTFRFFTPAMDARAQARSRLADELSGALSQGEFHLVFQPLVDVKSGKV
NAAEALLRWHNRYLGVVSPDQFVPLAEEIGLIRPIGEWLLTAACREALVWQGMGLGEINI
AVNISPRQFQQGDIVGIIRRALEDTRLPPWLLTIEITEGLLLSNGEEILAKMEAIRTLGV
SLSVDDFGTGYSSLSYLKSFPVDVLKIDRSFIADMGDHSDDATMVEAIIALGHSLHLEVV
AEGVETKQQLDFITAQGCDVAQGYYFSPPLSGPRFREFVLERLGLPEPEGMAGVAPHGVR
VLFADDVELVRLVFRDFLEGTGCVIDEAADGTQAIAKATAVRKDGGNRHQLMVFDLCMPG
VDGFEVARAVRLFEAANHLDPVPLIALTVDDSEESRERARQAGFDRFLTKPIARSELLAA
MAEMLPAANTDMAPADGSLTAGLNIPTGLEHLLPTFMAEMLKDQQTLRSLAEGRDRAALA
DHAHAMRGKCGMFGEEVLYSLLGDLESLAPLGDRGEITRLVAKVVERVGRL