Protein Info for AMB_RS06460 in Magnetospirillum magneticum AMB-1

Annotation: septation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 90 to 106 (17 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details PF04279: IspA" amino acids 12 to 184 (173 residues), 199 bits, see alignment E=3.6e-63 TIGR00997: intracellular septation protein A" amino acids 12 to 186 (175 residues), 173.4 bits, see alignment E=2.7e-55

Best Hits

Swiss-Prot: 49% identical to YCIB_BRASO: Probable intracellular septation protein A (BRADO0387) from Bradyrhizobium sp. (strain ORS 278)

KEGG orthology group: K06190, intracellular septation protein (inferred from 100% identity to mag:amb1270)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7V1 at UniProt or InterPro

Protein Sequence (192 amino acids)

>AMB_RS06460 septation protein A (Magnetospirillum magneticum AMB-1)
MPVSNSPAPKWLKPTVDFGPLAVFLGLYWLKGLLPATAALMAATGIALALSFAFTRKVAL
MPLVTALVVGVFGGLTLWLNDETFIMMKPSIVYGLFALVLGGGLALKRPTIKAILGEAMH
LDDDGWRRLSLRFCLFFLAMALANEVVRRVASMDLWVLWKVPGSMVLTFIFMLFQMPLIR
RHMPPDPASAGE