Protein Info for AMB_RS06360 in Magnetospirillum magneticum AMB-1

Annotation: EamA family transporter RarD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 127 to 144 (18 residues), see Phobius details amino acids 150 to 166 (17 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details TIGR00688: protein RarD" amino acids 7 to 259 (253 residues), 201.7 bits, see alignment E=7.1e-64 PF00892: EamA" amino acids 7 to 140 (134 residues), 50.9 bits, see alignment E=1.1e-17

Best Hits

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to mag:amb1253)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7W8 at UniProt or InterPro

Protein Sequence (291 amino acids)

>AMB_RS06360 EamA family transporter RarD (Magnetospirillum magneticum AMB-1)
MSAEHRRGVLFALACYGTWGLFPAFWKLLASVPPTEVLAYRVIWSLLTVMIMLTWTGRWG
EVLVLLASGRRLAVLAASTACISVNWLVFIRVVGEGNVLEASMGYFLNPLVNVALGVVVL
GERLRPLQWVAVGLALAGIVELAIGTGTAPWAALTLAGTFGVYGLLRKKLPVAPLTGLAV
ETGLMLPLAVAYLSWRVAEGAPLLGGSPELGAALLASGPVTALPLLWFAAAASRLRYATL
GFFQYLAPTGHFLLAVLVYGESPGPAHLITFGCIWAAIGLYLADSWRHSRR