Protein Info for AMB_RS06355 in Magnetospirillum magneticum AMB-1

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR00229: PAS domain S-box protein" amino acids 30 to 150 (121 residues), 73.2 bits, see alignment E=1e-24 PF13188: PAS_8" amino acids 33 to 87 (55 residues), 30 bits, see alignment 1.3e-10 PF00989: PAS" amino acids 36 to 143 (108 residues), 41.1 bits, see alignment E=5.7e-14 PF08448: PAS_4" amino acids 40 to 147 (108 residues), 34.9 bits, see alignment E=5.5e-12 PF13426: PAS_9" amino acids 46 to 145 (100 residues), 43.5 bits, see alignment E=1.2e-14 PF00512: HisKA" amino acids 167 to 231 (65 residues), 28.1 bits, see alignment E=5.9e-10 PF02518: HATPase_c" amino acids 275 to 385 (111 residues), 100.4 bits, see alignment E=2.9e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1252)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-); Cyanobacterial phytochrome B" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7W9 at UniProt or InterPro

Protein Sequence (386 amino acids)

>AMB_RS06355 PAS domain-containing sensor histidine kinase (Magnetospirillum magneticum AMB-1)
MDVCNKVEAGGGERRGRDRRQSDIEAVLRRTEAKFSTVFRACPDLIAITARSSGRFIEVN
DAFERIMGWSKSEVIGRTSADLETWESRDERDRMLAALGESSRLENFEVRFRRKSGEVFT
ALISLEATDLSGEPSLIFVARDISERKAEEMVLRRTAEELERSNMELERFAYVAAHDLLE
PCRTICSFAQMLDRKYADILDDEGREYLDFLVGGALRMRELIQGVLGYSRAGVAAAQMVE
VDLGRAAAEVVSDLGSALQARGGGVEVGPLPVVRGDPAQLRQLLGNLIGNGVKFHAEGTS
PRVRVFCGNRDGEWCVTVEDNGIGIAPEYQDDIFGIFRRLHGPDRYSGTGIGLAVARRIV
DAHGGRIWVESEPGWGARFRFTLPMV