Protein Info for AMB_RS06310 in Magnetospirillum magneticum AMB-1

Annotation: phenylacetyl CoA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 98 to 115 (18 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details PF04976: DmsC" amino acids 60 to 112 (53 residues), 22.9 bits, see alignment 2.6e-09

Best Hits

KEGG orthology group: K07308, anaerobic dimethyl sulfoxide reductase subunit C (DMSO reductase anchor subunit) (inferred from 100% identity to mag:amb1243)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7X8 at UniProt or InterPro

Protein Sequence (308 amino acids)

>AMB_RS06310 phenylacetyl CoA (Magnetospirillum magneticum AMB-1)
MSEEFEDAPAMRHQGLSPWLQTAWDLRAAGNFIGGGSGTGLLIIASLGAFDGLYSRVLLI
AGLALVGLGLFSVFLEIGRPLRALNVLLGAKRSWMTREAMVAAVLFPLGAAALIWPDLTK
LVWIPAAAYLYCQARILEAAKGIPTWRSPLILPLTIASGLAEGAGILLLLGTLALEGGAP
EWVAGTLVATIAARIFVWMFYRRRMVGGEAPVEAAAVLIRFSMPFTLGGNVIPIAFLVLA
GIQPDIRAAALAAAGLAAMAGGWAMKVVIVTKAAHNQGFAINHSPARGGGESGPGFKPGW
REVPKDKK