Protein Info for AMB_RS06265 in Magnetospirillum magneticum AMB-1

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 26 to 307 (282 residues), 217.6 bits, see alignment E=1e-68 PF01545: Cation_efflux" amino acids 30 to 234 (205 residues), 122.6 bits, see alignment E=9e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to mag:amb1234)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2W7Y7 at UniProt or InterPro

Protein Sequence (314 amino acids)

>AMB_RS06265 cation transporter (Magnetospirillum magneticum AMB-1)
MTRHVHDLTPWRHGHQYFSGGEAAAERRTLIVVALTVVMMVAEITAGTLFNSMALLADGW
HMSTHAGALGIAAFAYGFARRHAEDGRFTFGTGKVGVLGGFASAIVLGMVALLMVWESAS
RLREVQTIGFDEALWVAVIGLVVNLVSALILGGDGHTHDHSHDHGHDHHHDHNLRAAYVH
VVADAVTSVLAIVALLFGKYLGWWWMDPMMGLVGAAVIAKWSWGLMAETGAVLLDHSGDG
SLEQEVRAAIEGDADNRLADLHLWRVGAGHWAAIVSIVTHQPQPPDYYKRLLAPVHELSH
VTVEILPCVGEAKS